Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas putida Protease HtpX (htpX)

This Recombinant Pseudomonas putida Protease HtpX (htpX) spans the amino acid sequence from region 1-295.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

B1J4W3

Expression Region

1-295

Origin

Pseudomonas putida (strain W619)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRILLFVATNLAVVLVASITLSLFGFNGFMAANGVDLNLSSLLVFCAVFGFAGSLVSLF ISKWMAKMSTGTQIISQPRTRHEQWLLQTVEELSREAGIKMPEVGIFPAYEANAFATGWN RNDALVAVSQGLLERFSPDEVRAVLAHEIGHVANGDMVTLALVQGVVNTFVMFFARIIGN FVDKVIFKNEEGQGIAYYVATIVAELVLGILASMIVMWFSRRREYRADEAGAQLAGTAAM IGALQRLRVEQGLPVHMPDTMKAFGINGGLKHGLAGLLMSHPPLEERIEALRRRG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB6A Antibody
DF4407-01 100 µL

RAB6A Antibody

Sign In for Pricing
View Details
RAB6A Antibody
DF4407-02 200 µL

RAB6A Antibody

Sign In for Pricing
View Details
ST13P2 3'UTR Luciferase Stable Cell Line
TU024733 1.0 mL

ST13P2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Cavy Distal Less Homeobox 5 ELISA Kit
MBS042031 Inquire

Cavy Distal Less Homeobox 5 ELISA Kit

Sign In for Pricing
View Details
Big Endothelin-1 (Human, 22-38) Antiserum
14224-v 50 μL

Big Endothelin-1 (Human, 22-38) Antiserum

Sign In for Pricing
View Details
MYDGF Peptide - N-terminal region
MBS3241143-01 0.1 mg

MYDGF Peptide - N-terminal region

Sign In for Pricing
View Details