Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas entomophila Protease HtpX (htpX)

This Recombinant Pseudomonas entomophila Protease HtpX (htpX) spans the amino acid sequence from region 1-295.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

Q1ID18

Expression Region

1-295

Origin

Pseudomonas entomophila (strain L48)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRILLFVATNLAVVLVASITLSLFGFNGFMAANGVDLNLGQLLVFCAVFGFAGSLVSLF ISKWMAKMTTGTQIITQPRTRHEQWLLQTVEELSREAGIKMPEVGIFPAYEANAFATGWN RNDALVAVSQGLLERFSPDEVRAVLAHEIGHVANGDMVTMALVQGVVNTFVMFFARIIGN FVDRVIFKNEEGHGIAYFVATIVAELVLGILASIIVMWYSRRREFRADEAGAHLAGTGAM IGALQRLRSEQGLPVHMPDTMKAFGINGGLKHGLAGLLMSHPPLEDRIDALRRRG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HBEGF Rabbit Polyclonal Antibody (Biotin)
orb452983 100 µL

HBEGF Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Anti-Human CD93 PE
MBS696632-01 25 Tests

Anti-Human CD93 PE

Sign In for Pricing
View Details
Anti-Human CD93 PE
MBS696632-02 100 Tests

Anti-Human CD93 PE

Sign In for Pricing
View Details
Anti-Human CD93 PE
MBS696632-03 5x 100 Tests

Anti-Human CD93 PE

Sign In for Pricing
View Details
Neuropeptide Y (NPY) rabbit polyclonal antibody, Serum
BP162 250 µL

Neuropeptide Y (NPY) rabbit polyclonal antibody, Serum

Sign In for Pricing
View Details
THAP1, 1-213 aa, Human, His tag, E.coli
E53A04198 50 µg

THAP1, 1-213 aa, Human, His tag, E.coli

Sign In for Pricing
View Details