Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nitrosococcus oceani Protease HtpX (htpX)

This Recombinant Nitrosococcus oceani Protease HtpX (htpX) spans the amino acid sequence from region 1-295.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

Q3JE43

Expression Region

1-295

Origin

Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIKRVILFLATNLAVLLVLSISMRLLGIESLLNQQGTDLNLNALLIFAAIIGFSGSLISL AISKFTAKRLTGAQVIERPRSTTEVWLLETVQRHARMAGIGMPEVAIYASPEPNAFATGW NRNAALVAVSSGLLEQMNQNEVEAVLGHEISHVANGDMVTLALIQGVVNTFVIFLARIIG HLVDRVVFKTERGYGPAFFITTLIAQTVLAILASLIVLWFSRQREFRADAGGAQLAGKEK MIAALERLGRMAQEGLPEQLQAFGIAGGERSQGWKRLFMSHPPIEERIAALRAEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sodium Cholate Hydrate (Powder)
B2010155 1 g

Sodium Cholate Hydrate (Powder)

Sign In for Pricing
View Details
Kanamycin A
orb1992991-01 200 mg

Kanamycin A

Sign In for Pricing
View Details
Kanamycin A
orb1992991-02 500 mg

Kanamycin A

Sign In for Pricing
View Details
Kanamycin A
orb1992991-03 1 g

Kanamycin A

Sign In for Pricing
View Details
RBM4 (NM_002896) Human Recombinant Protein
TP307607 20 µg

RBM4 (NM_002896) Human Recombinant Protein

Sign In for Pricing
View Details
FMDV VP1 protein (type O) Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-41049R-BF405 100 µL

FMDV VP1 protein (type O) Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details