Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nitrosococcus oceani Protease HtpX (htpX)

This Recombinant Nitrosococcus oceani Protease HtpX (htpX) spans the amino acid sequence from region 1-295.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

Q3JE43

Expression Region

1-295

Origin

Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIKRVILFLATNLAVLLVLSISMRLLGIESLLNQQGTDLNLNALLIFAAIIGFSGSLISL AISKFTAKRLTGAQVIERPRSTTEVWLLETVQRHARMAGIGMPEVAIYASPEPNAFATGW NRNAALVAVSSGLLEQMNQNEVEAVLGHEISHVANGDMVTLALIQGVVNTFVIFLARIIG HLVDRVVFKTERGYGPAFFITTLIAQTVLAILASLIVLWFSRQREFRADAGGAQLAGKEK MIAALERLGRMAQEGLPEQLQAFGIAGGERSQGWKRLFMSHPPIEERIAALRAEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HDAC1 mouse monoclonal antibody, clone 5C11, Purified
AM31797PU-N 50 µg

HDAC1 mouse monoclonal antibody, clone 5C11, Purified

Sign In for Pricing
View Details
Calcium sensing receptor, chloroplastic Antibody
MBS7143358 Inquire

Calcium sensing receptor, chloroplastic Antibody

Sign In for Pricing
View Details
5-Formyl-2-furoic acid
OR200110-01 1 g

5-Formyl-2-furoic acid

Sign In for Pricing
View Details
5-Formyl-2-furoic acid
OR200110-02 5 g

5-Formyl-2-furoic acid

Sign In for Pricing
View Details
5-Formyl-2-furoic acid
OR200110-03 100 g

5-Formyl-2-furoic acid

Sign In for Pricing
View Details
UTRN Protein Vector (Mouse) (pPB-C-His)
PV244758 500 ng

UTRN Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details