Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Trimeric intracellular cation channel type A (tmem38a)

This Recombinant Danio rerio Trimeric intracellular cation channel type A (tmem38a) spans the amino acid sequence from region 1-295.

Product Specifications

Product Name Alternative

Trimeric intracellular cation channel type A, TRIC-A, TRICA, Transmembrane protein 38A

UniProt

Q6P2T0

Expression Region

1-295

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEVLDVLNLGEIAQYFSKMAMFPVFDVAYYIVSILYLKYEPGAVEVSRRSPVASWLCAML YCFGSYILADIMLGVCPIDYFHNNSHILLASAVWYLIFFCPLNLFYKCVAFMPVKLVLVA LKEVVRTRKIAAGVHHAHHAYHHGWLIMVITGYVKGSGVALMSNFEQLLRGVWKPETNEV LNMSFPTKASLYGAILFTLQEAHVLPVSKSTLICLFTLFMVSSKVFMTARHSHGSPFALI ESWVCHVLFGSPLGTEDAHDHHHAAPAAAPAPLSPAKNKEELSEGTRKRKSKKAE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD43 (84-3C1), CF488A conjugate, 0.1mg/mL
BNC880342-100 1x 100 µL

CD43 (84-3C1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF740 conjugate, 0.1mg/mL
BNC741073-100 1x 100 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF640R conjugate, 0.1mg/mL
BNC400204-100 1x 100 µL

Complement C4d (C4D204), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF514 conjugate, 0.1mg/mL
BNC140017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF514 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), Biotin conjugate, 0.1mg/mL
BNCB0871-500 1x 500 µL

CD71 (66IG10), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (Ki-1/1505R), CF640R conjugate, 0.1mg/mL
BNC401505-100 1x 100 µL

CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (Ki-1/1505R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details