Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas putida Protease HtpX (htpX)

This Recombinant Pseudomonas putida Protease HtpX (htpX) spans the amino acid sequence from region 1-295.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

Q88LQ8

Expression Region

1-295

Origin

Pseudomonas putida (strain KT2440)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRILLFVATNLAVVLVASITLSLFGFNGFMAANGVDLNLSSLLVFCAVFGFAGSLVSLF ISKWMAKMTTGTQIISQPRTRHEQWLLQTVEELSREAGIKMPEVGIFPAYEANAFATGWN RNDALVAVSQGLLERFSPDEVRAVLAHEIGHVANGDMVTLALVQGVVNTFVMFFARIIGN FVDKVIFKNEEGQGIAYYVATIVAELILGILASMIVMWFSRRREFRADEAGAQLAGTAAM IGALQRLRVEQGLPVHMPDTMKAFGINGGLKHGLAGLLMSHPPLEDRIEALRQRG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Colon
CS622027 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
elF2 alpha (EIF2S1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3H4]
TA501313BM 100 µL

elF2 alpha (EIF2S1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3H4]

Sign In for Pricing
View Details
Cytokeratin 7 (KRT7/1198), CF640R conjugate, 0.1mg/mL
BNC401198-100 1x 100 µL

Cytokeratin 7 (KRT7/1198), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human TIMP-1 Antibody Pair Set
E-KAB-0067 50 µL & 100 µg

Human TIMP-1 Antibody Pair Set

Sign In for Pricing
View Details
2-Naphthol-d7
TRC-N368018-250MG 250 mg

2-Naphthol-d7

Sign In for Pricing
View Details
NLRP3 (C-term) Goat Polyclonal Antibody
AP22372PU-N 100 µg

NLRP3 (C-term) Goat Polyclonal Antibody

Sign In for Pricing
View Details