Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas putida Protease HtpX (htpX)

This Recombinant Pseudomonas putida Protease HtpX (htpX) spans the amino acid sequence from region 1-295.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

Q88LQ8

Expression Region

1-295

Origin

Pseudomonas putida (strain KT2440)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRILLFVATNLAVVLVASITLSLFGFNGFMAANGVDLNLSSLLVFCAVFGFAGSLVSLF ISKWMAKMTTGTQIISQPRTRHEQWLLQTVEELSREAGIKMPEVGIFPAYEANAFATGWN RNDALVAVSQGLLERFSPDEVRAVLAHEIGHVANGDMVTLALVQGVVNTFVMFFARIIGN FVDKVIFKNEEGQGIAYYVATIVAELILGILASMIVMWFSRRREFRADEAGAQLAGTAAM IGALQRLRVEQGLPVHMPDTMKAFGINGGLKHGLAGLLMSHPPLEDRIEALRQRG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Benzoylpropanoic Acid
TRC-B208800-5G 5 g

3-Benzoylpropanoic Acid

Sign In for Pricing
View Details
4,6-Di(pyridin-3-yl)piperidin-2-one
TRC-D492705-5MG 5 mg

4,6-Di(pyridin-3-yl)piperidin-2-one

Sign In for Pricing
View Details
Precision Balance BBAL-202
BBAL-202 1 Unit

Precision Balance BBAL-202

Sign In for Pricing
View Details
PKC mu (PRKD1) (NM_002742) Human Recombinant Protein
TP311676 20 µg

PKC mu (PRKD1) (NM_002742) Human Recombinant Protein

Sign In for Pricing
View Details
Human GDF15 (Growth Differentiation Factor 15) CLIA Kit
E-CL-H0080-01 24 Tests

Human GDF15 (Growth Differentiation Factor 15) CLIA Kit

Sign In for Pricing
View Details
Human GDF15 (Growth Differentiation Factor 15) CLIA Kit
E-CL-H0080-02 48 Tests

Human GDF15 (Growth Differentiation Factor 15) CLIA Kit

Sign In for Pricing
View Details