Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis Trimeric intracellular cation channel type A (tmem38a)

This Recombinant Xenopus laevis Trimeric intracellular cation channel type A (tmem38a) spans the amino acid sequence from region 1-295.

Product Specifications

Product Name Alternative

Trimeric intracellular cation channel type A, TRIC-A, TRICA, Transmembrane protein 38A

UniProt

Q7ZY07

Expression Region

1-295

Origin

Xenopus laevis (African clawed frog)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELLSALSLDDLAASFSKLPVFPLFDVAYYIISILYLKYEPGAVDLSKRSPVASWLCAML YCFGSYILADVLLGESPIHYFSNNANILLASAVWYLTFFCPLNIFYKIVSFLPVKLVLVG MKEVVRVRKIAMGIHHAHHHYHHGWVIMVLIGWVKGSGVALMSNLEQLLRGVWKPETNEI LHMSFPTKASLYGAILFTLQQAHWLPISKAYLIFFFTLFMAVCKIYMTATHSHGSPFAIF ESGICYVLFAAANGDHDDHGNHHHHHDDHDVSHSAGKSKEEHNEGTRKRKTKKAE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXP3 (3G3), CF740 conjugate, 0.1mg/mL
BNC740645-500 1x 500 µL

FOXP3 (3G3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF405S conjugate, 0.1mg/mL
BNC040437-500 1x 500 µL

CD47 (B6H12.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF568 conjugate, 0.1mg/mL
BNC680333-100 1x 100 µL

CD8 (RIV11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF640R conjugate, 0.1mg/mL
BNC400345-100 1x 100 µL

CD4 (EDU-2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (VWF/1859R), CF405S conjugate, 0.1mg/mL
BNC041859-100 1x 100 µL

Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (VWF/1859R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NKX6.1 (Marker for Pancreatic and Duodenal Neuroendocrine Tumors) (NKX61/2561), CF488A conjugate, 0.1mg/mL
BNC882561-500 1x 500 µL

NKX6.1 (Marker for Pancreatic and Duodenal Neuroendocrine Tumors) (NKX61/2561), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details