Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Presqualene diphosphate phosphatase (PPAPDC2)

This Recombinant Human Presqualene diphosphate phosphatase (PPAPDC2) spans the amino acid sequence from region 1-295.

Product Specifications

Product Name Alternative

Presqualene diphosphate phosphatase, EC= 3.1.3.-, Phosphatidic acid phosphatase type 2 domain-containing protein 2, PPAP2 domain-containing protein 2

UniProt

Q8IY26

Expression Region

1-295

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPSPRRSMEGRPLGVSASSSSSSPGSPAHGGGGGGSRFEFQSLLSSRATAVDPTCARLRA SESPVHRRGSFPLAAAGPSQSPAPPLPEEDRMDLNPSFLGIALRSLLAIDLWLSKKLGVC AGESSSWGSVRPLMKLLEISGHGIPWLLGTLYCLCRSDSWAGREVLMNLLFALLLDLLLV ALIKGLVRRRRPAHNQMDMFVTLSVDKYSFPSGHATRAALMSRFILNHLVLAIPLRVLVV LWAFVLGLSRVMLGRHNVTDVAFGFFLGYMQYSIVDYCWLSPHNAPVLFLLWSQR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hamster Immunoglobulin Heavy Constant Gamma 2 (IGHG2) ELISA Kit
MBS9920384-01 48 Well

Hamster Immunoglobulin Heavy Constant Gamma 2 (IGHG2) ELISA Kit

Sign In for Pricing
View Details
Hamster Immunoglobulin Heavy Constant Gamma 2 (IGHG2) ELISA Kit
MBS9920384-02 96 Well

Hamster Immunoglobulin Heavy Constant Gamma 2 (IGHG2) ELISA Kit

Sign In for Pricing
View Details
Hamster Immunoglobulin Heavy Constant Gamma 2 (IGHG2) ELISA Kit
MBS9920384-03 5x 96 Well

Hamster Immunoglobulin Heavy Constant Gamma 2 (IGHG2) ELISA Kit

Sign In for Pricing
View Details
Hamster Immunoglobulin Heavy Constant Gamma 2 (IGHG2) ELISA Kit
MBS9920384-04 10x 96 Well

Hamster Immunoglobulin Heavy Constant Gamma 2 (IGHG2) ELISA Kit

Sign In for Pricing
View Details
Palmitoyl-Gly-Gln-Pro-Arg-OH
4145516.2005 5 g

Palmitoyl-Gly-Gln-Pro-Arg-OH

Sign In for Pricing
View Details
KIF2A Rabbit Polyclonal Antibody (Biotin)
orb2135846 100 µL

KIF2A Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details