Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Presqualene diphosphate phosphatase (PPAPDC2)

This Recombinant Human Presqualene diphosphate phosphatase (PPAPDC2) spans the amino acid sequence from region 1-295.

Product Specifications

Product Name Alternative

Presqualene diphosphate phosphatase, EC= 3.1.3.-, Phosphatidic acid phosphatase type 2 domain-containing protein 2, PPAP2 domain-containing protein 2

UniProt

Q8IY26

Expression Region

1-295

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPSPRRSMEGRPLGVSASSSSSSPGSPAHGGGGGGSRFEFQSLLSSRATAVDPTCARLRA SESPVHRRGSFPLAAAGPSQSPAPPLPEEDRMDLNPSFLGIALRSLLAIDLWLSKKLGVC AGESSSWGSVRPLMKLLEISGHGIPWLLGTLYCLCRSDSWAGREVLMNLLFALLLDLLLV ALIKGLVRRRRPAHNQMDMFVTLSVDKYSFPSGHATRAALMSRFILNHLVLAIPLRVLVV LWAFVLGLSRVMLGRHNVTDVAFGFFLGYMQYSIVDYCWLSPHNAPVLFLLWSQR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bloc1s3 3'UTR Luciferase Stable Cell Line
TU102768 1.0 mL

Bloc1s3 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Klk7 Antibody, Biotin conjugated
CSB-PA012458LD01RA-01 50 µg

Klk7 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Klk7 Antibody, Biotin conjugated
CSB-PA012458LD01RA-02 100 µg

Klk7 Antibody, Biotin conjugated

Sign In for Pricing
View Details
ITFG3 (Protein ITFG3, Integrin Alpha FG-GAP Repeat Containing 3)
483743 100 µL

ITFG3 (Protein ITFG3, Integrin Alpha FG-GAP Repeat Containing 3)

Sign In for Pricing
View Details
MS436
C12589-25mg 25 mg

MS436

Sign In for Pricing
View Details
Phospho-heterochromatin protein 1 (pTyr41) Rabbit pAb, PerCP-Cy7 conjugated
orb2843255 100 µL

Phospho-heterochromatin protein 1 (pTyr41) Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details