Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cryptococcus gattii serotype B High osmolarity signaling protein SHO1 (SHO1)

This Recombinant Cryptococcus gattii serotype B High osmolarity signaling protein SHO1 (SHO1) spans the amino acid sequence from region 1-296.

Product Specifications

Product Name Alternative

High osmolarity signaling protein SHO1, Osmosensor SHO1

UniProt

E6RET3

Expression Region

1-296

Origin

Cryptococcus gattii serotype B (strain WM276 / ATCC MYA-4071) (Filobasidiella gattii) (Cryptococcus bacillisporus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFGGHSFDVGYVMRHPVFLVTFIIAIPSWIIAFAGQCAAEAKYSSSNGRTPVAGTLWFNI WLQLMLTVSLAISSDDLALHRFQLSIFLAIATALAVGGVEFIFQTPGAYIAIGVGWLLLT MVNLVWIVYLTSEEDTFLYNVLNSGGNGGLSSHNRRIGTSVQRRDETPGYGGGEMGLGNS MGGMPRGISSNTINSGGYGGGYAPASMEGTPQKVTSVTRNEYGHTGVQSPGIDESVPRPQ RAKALYAYSASPDDPNEVSFMKGEILEVVDATGKWFQVRTPAGVTGIAPSNYLVLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (HFN7.1), CF647 conjugate, 0.1mg/mL
BNC470270-100 1x 100 µL

Fibronectin (HFN7.1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF770 conjugate, 0.1mg/mL
BNC700745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF647 conjugate, 0.1mg/mL
BNC470460-100 1x 100 µL

CD44 Standard (156-3C11), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF555 conjugate, 0.1mg/mL
BNC551050-500 1x 500 µL

CD3e (CRIS-7), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/2340R), CF740 conjugate, 0.1mg/mL
BNC742340-100 1x 100 µL

Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/2340R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 10 (KRT10/844), CF405S conjugate, 0.1mg/mL
BNC040844-100 1x 100 µL

Cytokeratin 10 (KRT10/844), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details