Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein yphB (yphB)

This Recombinant Bacillus subtilis Uncharacterized protein yphB (yphB) spans the amino acid sequence from region 1-297.

Product Specifications

Product Name Alternative

Uncharacterized protein yphB

UniProt

P50742

Expression Region

1-297

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDYIYPIIAGVIAGIATRLYMLKTDYRQYPTYVHGKVIHIALGLIAAGLGAIIMPALLQ EEFTAITFLTLAATQFRDVRNMERNTLTQMDSYELVSRGSTYIEGIAIAFESRNYIVIFT ALLTTSAYVFLSIWAAVIAAVVCFLLAMKFMSGSVLKDIVDIEYIKPRFDGPGLFVDNIY MMNIGLPEKQELILKHGMGFILTPKNFNSAATIANLGQRQAILFDVSNVLGVYRDSGEPS LTPIAKRDLNDGRVAVFVLPQIHHPETAVQIISNVPTLENAIRMPTEFIKNQDKVIG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Tomm40l shRNA (UAS) - Lentiviral mouse Tomm40l shRNA (UAS, GFP) plasmid
GTR15279994 1 Vial

Lentiviral mouse Tomm40l shRNA (UAS) - Lentiviral mouse Tomm40l shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
IL-21, Recombinant, Human (Interleukin-21) discontinued
219933 10 µg

IL-21, Recombinant, Human (Interleukin-21) discontinued

Sign In for Pricing
View Details
LTB Antibody
orb1554030-01 50 μL

LTB Antibody

Sign In for Pricing
View Details
LTB Antibody
orb1554030-02 100 µL

LTB Antibody

Sign In for Pricing
View Details
LTB Antibody
orb1554030-03 200 µL

LTB Antibody

Sign In for Pricing
View Details
OR7E25P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
35601061 1.0 µg DNA

OR7E25P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details