Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cell division protein FtsX homolog (ftsX)

This Recombinant Cell division protein FtsX homolog (ftsX) spans the amino acid sequence from region 1-297.

Product Specifications

Product Name Alternative

Cell division protein FtsX homolog

UniProt

Q7TX91

Expression Region

1-297

Origin

Mycobacterium bovis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRFGFLLNEVLTGFRRNVTMTIAMILTTAISVGLFGGGMLVVRLADSSRAIYLDRVESQV FLTEDVSANDSSCDTTACKALREKIETRSDVKAVRFLNRQQAYDDAIRKFPQFKDVAGKD SFPASFIVKLENPEQHKDFDTAMKGQPGVLDVLNQKELIDRLFAVLDGLSSAAFAVALVQ AIGAILLIANMVQVAAYTRRTEIGIMRLVGASRWYTQLPFLVEAMLAATMGVGIAVAGLM VVRALFLENALNQFYQANLIAKVDYADILFITPWLLLLGVAMSGLTAYLTLRLYVRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD31 / PECAM-1 (158-2B3), CF488A conjugate, 0.1mg/mL
BNC880352-100 1x 100 µL

CD31 / PECAM-1 (158-2B3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF640R conjugate, 0.1mg/mL
BNC401231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL
BNC740669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
S100A4 (Marker of Tumor Metastasis) (S100A4/1482), CF405S conjugate, 0.1mg/mL
BNC041482-100 1x 100 µL

S100A4 (Marker of Tumor Metastasis) (S100A4/1482), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
S100A4 (Marker of Tumor Metastasis) (S100A4/2750R), CF488A conjugate, 0.1mg/mL
BNC882750-500 1x 500 µL

S100A4 (Marker of Tumor Metastasis) (S100A4/2750R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8 (K8.8), CF594 conjugate, 0.1mg/mL
BNC940689-100 1x 100 µL

Cytokeratin 8 (K8.8), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details