Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Trimeric intracellular cation channel type A (Tmem38a)

This Recombinant Rat Trimeric intracellular cation channel type A (Tmem38a) spans the amino acid sequence from region 1-297.

Product Specifications

Product Name Alternative

Trimeric intracellular cation channel type A, TRIC-A, TRICA, 27 kDa sarcoplasmic reticulum protein, SPR-27, Transmembrane protein 38A

UniProt

A6ZIQ8

Expression Region

1-297

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLISSLSLGELALSFSRVPLFPVFDLSYFIVSIIYLKYEPGSVELSRRHPVASWLCAML HCFGSYILADLLLGEPIIDYFSNSSSILLASGVWYLIFFCPLDLFYKCVCFLPVKLIFVA MKEVVRVRKIAVGIHHAHHYHHGWFIMIATGWVKGSGVALLSNLEQLLRGVWKPETNEIL HMSFPTKASLYGAILFTLQQTRWLPVSKASLIFVFTMFMVSCKVFLTATHSHSSPFDVLE GYICPVLFGATWGGDHHHDNHGAPHGMGLGTQHSGLPAKAKEELSEGFRKKKTKKAD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 5AC (MUC5AC) (58M1), CF740 conjugate, 0.1mg/mL
BNC741003-100 1x 100 µL

Mucin 5AC (MUC5AC) (58M1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF568 conjugate, 0.1mg/mL
BNC680978-500 1x 500 µL

CD7 (T3-3A1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cyclin B1 (V92.1), CF647 conjugate, 0.1mg/mL
BNC470680-500 1x 500 µL

Cyclin B1 (V92.1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-2 (124), CF568 conjugate, 0.1mg/mL
BNC680530-100 1x 100 µL

Bcl-2 (124), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/2580), CF488A conjugate, 0.1mg/mL
BNC882580-500 1x 500 µL

CD10 (Membrane Metalloendopeptidase) (MME/2580), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26 + 57), CF568 conjugate, 0.1mg/mL
BNC681025-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26 + 57), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details