Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pyogenes serotype M5 Protease HtpX homolog (htpX)

This Recombinant Streptococcus pyogenes serotype M5 Protease HtpX homolog (htpX) spans the amino acid sequence from region 1-298.

Product Specifications

Product Name Alternative

Protease HtpX homolog, EC= 3.4.24.-

UniProt

A2RGB7

Expression Region

1-298

Origin

Streptococcus pyogenes serotype M5 (strain Manfredo)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLYQQISQNKQRTVVLLVVFFALLALIGASAGYLLLDNYAMGLVLALVIGVIYATSMIFQ STSLVMSMNNAREVTEKEAPGFFHIVEDMAMVAQIPMPRVFIIEDPSLNAFATGSSPQNA AVAATTGLLEVMNREELEGVIGHEISHIRNYDIRISTIAVALASAVTVISSIGGRMLWYG GGSRRQRDDGDDDVLRIITLLLSLLSLLLAPLVASLIQLAISRQREYLADASSVELTRNP QGMIKALEKLQLSQPMKHPVDDASAALYINEPRKKRSFSSLFSTHPPIEERIERLKNM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HDAC10 Rabbit Polyclonal Antibody (PE)
orb2611956 100 µg

HDAC10 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
DAPK2 (Death-associated Protein Kinase 2, DAP Kinase 2, DAP-kinase Related Protein 1, DRP-1) (MaxLight 550)
MBS6211073-01 0.1 mL

DAPK2 (Death-associated Protein Kinase 2, DAP Kinase 2, DAP-kinase Related Protein 1, DRP-1) (MaxLight 550)

Sign In for Pricing
View Details
DAPK2 (Death-associated Protein Kinase 2, DAP Kinase 2, DAP-kinase Related Protein 1, DRP-1) (MaxLight 550)
MBS6211073-02 5x 0.1 mL

DAPK2 (Death-associated Protein Kinase 2, DAP Kinase 2, DAP-kinase Related Protein 1, DRP-1) (MaxLight 550)

Sign In for Pricing
View Details
TMEM56 Protein Vector (Human) (pPB-N-His)
PV059038 500 ng

TMEM56 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
CYP2C9 Polyclonal Antibody, APC Conjugated
bs-20243R-APC 100 µL

CYP2C9 Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
Human Syntaxin 16 (STX16) ELISA Kit
YLA3239HU-01 48 Tests

Human Syntaxin 16 (STX16) ELISA Kit

Sign In for Pricing
View Details