Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pyogenes serotype M5 Protease HtpX homolog (htpX)

This Recombinant Streptococcus pyogenes serotype M5 Protease HtpX homolog (htpX) spans the amino acid sequence from region 1-298.

Product Specifications

Product Name Alternative

Protease HtpX homolog, EC= 3.4.24.-

UniProt

A2RGB7

Expression Region

1-298

Origin

Streptococcus pyogenes serotype M5 (strain Manfredo)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLYQQISQNKQRTVVLLVVFFALLALIGASAGYLLLDNYAMGLVLALVIGVIYATSMIFQ STSLVMSMNNAREVTEKEAPGFFHIVEDMAMVAQIPMPRVFIIEDPSLNAFATGSSPQNA AVAATTGLLEVMNREELEGVIGHEISHIRNYDIRISTIAVALASAVTVISSIGGRMLWYG GGSRRQRDDGDDDVLRIITLLLSLLSLLLAPLVASLIQLAISRQREYLADASSVELTRNP QGMIKALEKLQLSQPMKHPVDDASAALYINEPRKKRSFSSLFSTHPPIEERIERLKNM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMA4 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-12260R-BF680 100 µL

PSMA4 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) CBSDUFCH2 Polyclonal Antibody
MBS9001631 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) CBSDUFCH2 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Klebsiella Pneumoniae speA Protein (aa 1-632)
VAng-Cr5457-inquire Inquire

Recombinant Klebsiella Pneumoniae speA Protein (aa 1-632)

Sign In for Pricing
View Details
Recombinant Human DAPP1 Protein - (Dry Ice)
H00027071-P02-10ug 10 µg

Recombinant Human DAPP1 Protein - (Dry Ice)

Sign In for Pricing
View Details
Anti-NTMT1 Antibody
MBS8292394-01 0.03 mL

Anti-NTMT1 Antibody

Sign In for Pricing
View Details
Anti-NTMT1 Antibody
MBS8292394-02 0.05 mL

Anti-NTMT1 Antibody

Sign In for Pricing
View Details