Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Alcanivorax borkumensis Protease HtpX (htpX)

This Recombinant Alcanivorax borkumensis Protease HtpX (htpX) spans the amino acid sequence from region 1-298.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

Q0VQC0

Expression Region

1-298

Origin

Alcanivorax borkumensis (strain SK2 / ATCC 700651 / DSM 11573)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRIALYLLTNLAVIVVASITLSLLGVDSYLAQNGSGLNLTSLLIFSAVFGFAGSLISLL ISKPMAKWSAKVQTINEPSNQAERWLLDTVKELSDKAGIKMPEVGVFPAQQSNAFATGWN KNDALVAVSQGLLTRFRPEEVRAVLAHEIGHVANGDMVTLSLIQGVVNTFVIFAARVVGY VIDSFMRRDGGGGLGFGYYIVVIVTEIIFGIAASTIVMKFSRFREYRADVAGAQLADRRD MISALQRLKAEAKVPNQMPDSLVAFGINSGVKQGLKALFSSHPPLDDRIAALQEKRHG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD7 (T3-3A1), CF405S conjugate, 0.1mg/mL
BNC040978-500 1x 500 µL

CD7 (T3-3A1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calponin-1 (CALP), CF594 conjugate, 0.1mg/mL
BNC940831-500 1x 500 µL

Calponin-1 (CALP), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), Biotin conjugate, 0.1mg/mL
BNCB1820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (LAMP3/968), CF405M conjugate, 0.1mg/mL
BNC050968-500 1x 500 µL

CD63 (LAMP3/968), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rMOC-31), CF640R conjugate, 0.1mg/mL
BNC401819-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (rMOC-31), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF647 conjugate, 0.1mg/mL
BNC470017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details