Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Thiomicrospira crunogena Protease HtpX (htpX)

This Recombinant Thiomicrospira crunogena Protease HtpX (htpX) spans the amino acid sequence from region 1-298.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

Q31F55

Expression Region

1-298

Origin

Thiomicrospira crunogena (strain XCL-2)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKRIGLFLLTNIAVLAVAMITMNLLGVGSYMQGTSLDLGNLFAFAAIIGFAGSFVSLAMS KWLAKMSVGAKVIKEPRNADEQWLVETVRRQAEKAGIGMPEVAIYEGAEPNAFATGMTKN SALVAVSTGLLRHMRQNEVEAVLGHEVAHIANGDMVTMALLQGVVNTFVIFFAKIVAYVV DRVVLKNESEGHSITFIVVDIVAQILFGILASMITMWFSRKREFHADNGGAYLAGKENMI AALQRLQTMQPGELPDQMAAFGISARPSNIGDLFRSHPPLEKRIEALRATTQDQLKVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal Anti-Annexin I Antibody
GWB-BBP027 0.1 mg

Polyclonal Anti-Annexin I Antibody

Sign In for Pricing
View Details
NDE1 Antibody
orb679800 100 µL

NDE1 Antibody

Sign In for Pricing
View Details
Bovine Aldehyde Oxidase 1 (AOX1) ELISA Kit
DLR-AOX1-b-48T 48 Tests

Bovine Aldehyde Oxidase 1 (AOX1) ELISA Kit

Sign In for Pricing
View Details
9 (S) -HODE
sc-205194 100 µg

9 (S) -HODE

Sign In for Pricing
View Details
Phospho-IP3 Receptor (Ser1756) Rabbit mAb
F1383-20uL 20 µL

Phospho-IP3 Receptor (Ser1756) Rabbit mAb

Sign In for Pricing
View Details
Zinc Finger Protein 680 (ZNF680) Antibody
abx306239-01 20 µg

Zinc Finger Protein 680 (ZNF680) Antibody

Sign In for Pricing
View Details