Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Thiomicrospira crunogena Protease HtpX (htpX)

This Recombinant Thiomicrospira crunogena Protease HtpX (htpX) spans the amino acid sequence from region 1-298.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

Q31F55

Expression Region

1-298

Origin

Thiomicrospira crunogena (strain XCL-2)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKRIGLFLLTNIAVLAVAMITMNLLGVGSYMQGTSLDLGNLFAFAAIIGFAGSFVSLAMS KWLAKMSVGAKVIKEPRNADEQWLVETVRRQAEKAGIGMPEVAIYEGAEPNAFATGMTKN SALVAVSTGLLRHMRQNEVEAVLGHEVAHIANGDMVTMALLQGVVNTFVIFFAKIVAYVV DRVVLKNESEGHSITFIVVDIVAQILFGILASMITMWFSRKREFHADNGGAYLAGKENMI AALQRLQTMQPGELPDQMAAFGISARPSNIGDLFRSHPPLEKRIEALRATTQDQLKVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E-Ras shRNA (m) Lentiviral Particles
sc-60565-V 200 µL

E-Ras shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
ROS1 Antibody
orb1559284-01 50 µL

ROS1 Antibody

Sign In for Pricing
View Details
ROS1 Antibody
orb1559284-02 100 µL

ROS1 Antibody

Sign In for Pricing
View Details
ROS1 Antibody
orb1559284-03 200 µL

ROS1 Antibody

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Endoplasmic Reticulum Aminopeptidase 2 (ERAP2)
MBS2078108-01 0.1 mL

APC-Linked Polyclonal Antibody to Endoplasmic Reticulum Aminopeptidase 2 (ERAP2)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Endoplasmic Reticulum Aminopeptidase 2 (ERAP2)
MBS2078108-02 0.2 mL

APC-Linked Polyclonal Antibody to Endoplasmic Reticulum Aminopeptidase 2 (ERAP2)

Sign In for Pricing
View Details