Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant 34 kDa antigenic protein (MAP_0900)

This Recombinant 34 kDa antigenic protein (MAP_0900) spans the amino acid sequence from region 1-298.

Product Specifications

Product Name Alternative

34 kDa antigenic protein

UniProt

Q04959

Expression Region

1-298

Origin

Mycobacterium paratuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTYSPGSPGYPPAQSGGTYAGATPSFAKDDDGKSKLPLYLNIAVVALGFAAYLLNFGPTF TIGADLGPGIGGRAGDAGTAVVVALLAALLAGLGLLPKAKSYVGVVAVVAVLAALLAITE TINLPAGFAIGWAMWPLVACVVLQAIAAVVVVLLDAGVITAPAPRPKYDPYAQYGQYGQY GQYGQQPYYGQPGGQPGGQPGGQQHSPQGYGSQYGGYGQGGAPTGGFGAQPSPQSGPQQS AQQQGPSTPPTGFPSFSPPPNVGGGSDSGSATANYSEQAGGQQSYGQEPSSPSGPTPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEK1 (MAP2K1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A9]
TA506009BM 100 µL

MEK1 (MAP2K1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A9]

Sign In for Pricing
View Details
HEC1 (NDC80) (NM_006101) Human Recombinant Protein
TP307565M 100 µg

HEC1 (NDC80) (NM_006101) Human Recombinant Protein

Sign In for Pricing
View Details
6-HEX phosphoramidite [5'-Hexachlorofluorescein phosphoramidite]
6026-AAT 100 µmole

6-HEX phosphoramidite [5'-Hexachlorofluorescein phosphoramidite]

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), 1mg/mL
BNUM0253-50 1x 50 µL

Cytokeratin, LMW (AE-1), 1mg/mL

Sign In for Pricing
View Details
Sulfite oxidase Antibody
KC-12209-01 50 μL

Sulfite oxidase Antibody

Sign In for Pricing
View Details
Sulfite oxidase Antibody
KC-12209-02 100 µL

Sulfite oxidase Antibody

Sign In for Pricing
View Details