Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant 34 kDa antigenic protein (MAP_0900)

This Recombinant 34 kDa antigenic protein (MAP_0900) spans the amino acid sequence from region 1-298.

Product Specifications

Product Name Alternative

34 kDa antigenic protein

UniProt

Q04959

Expression Region

1-298

Origin

Mycobacterium paratuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTYSPGSPGYPPAQSGGTYAGATPSFAKDDDGKSKLPLYLNIAVVALGFAAYLLNFGPTF TIGADLGPGIGGRAGDAGTAVVVALLAALLAGLGLLPKAKSYVGVVAVVAVLAALLAITE TINLPAGFAIGWAMWPLVACVVLQAIAAVVVVLLDAGVITAPAPRPKYDPYAQYGQYGQY GQYGQQPYYGQPGGQPGGQPGGQQHSPQGYGSQYGGYGQGGAPTGGFGAQPSPQSGPQQS AQQQGPSTPPTGFPSFSPPPNVGGGSDSGSATANYSEQAGGQQSYGQEPSSPSGPTPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VSTM1 Antibody
KC-46682-01 50 μL

VSTM1 Antibody

Sign In for Pricing
View Details
VSTM1 Antibody
KC-46682-02 100 µL

VSTM1 Antibody

Sign In for Pricing
View Details
VSTM1 Antibody
KC-46682-03 1 mL

VSTM1 Antibody

Sign In for Pricing
View Details
p75 NGF Receptor (NGFR) (1-160) Mouse Monoclonal Antibody [Clone ID: NGFR5]
AM00235BT-N 100 µg

p75 NGF Receptor (NGFR) (1-160) Mouse Monoclonal Antibody [Clone ID: NGFR5]

Sign In for Pricing
View Details
Tissue Total RNA, Soft tissue
CR561430 5 µg

Tissue Total RNA, Soft tissue

Sign In for Pricing
View Details
TRIM27 Human Gene Knockout Kit (CRISPR)
KN402184 1 Kit

TRIM27 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details