Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pneumoniae Protease HtpX homolog (htpX)

This Recombinant Streptococcus pneumoniae Protease HtpX homolog (htpX) spans the amino acid sequence from region 1-299.

Product Specifications

Product Name Alternative

Protease HtpX homolog, EC= 3.4.24.-

UniProt

B1IC73

Expression Region

1-299

Origin

Streptococcus pneumoniae (strain Hungary19A-6)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLFDQIASNKRKTWILLLVFFLLLALVGYAVGYLFIRSGLGGLVIALIIGFIYALSMIFQ STEIVMSMNGAREVDEQTAPDLYHVVEDMALVAQIPMPRVFIIDDPALNAFATGSNPQNA AVAATSGLLAIMNREELEAVMGHEVSHIRNYDIRISTIAVALVSAITMLSGMAGRMMWWG GAGRRRSDDDRDGNGLEIIMLVVSLLAIVLAPLAATLVQLAISRQREFLADASSVELTRN PQGMINALDKLDNSKPMSRHVDDASSALYINDPKKGGGFQKLFYTHPPISERIERLKQM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human KISS1 (Kisspeptin 1) ELISA Kit
E-EL-H6099-01 24 Tests

Human KISS1 (Kisspeptin 1) ELISA Kit

Sign In for Pricing
View Details
Human KISS1 (Kisspeptin 1) ELISA Kit
E-EL-H6099-02 48 Tests

Human KISS1 (Kisspeptin 1) ELISA Kit

Sign In for Pricing
View Details
Human KISS1 (Kisspeptin 1) ELISA Kit
E-EL-H6099-03 96 Tests

Human KISS1 (Kisspeptin 1) ELISA Kit

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS638804 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
FOXO1 Rabbit Polyclonal Antibody
AP20978PU-N 100 µg

FOXO1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
5-Hepteneoylglycine(mixture of E/Z conformers)
TRC-H442960-100MG 100 mg

5-Hepteneoylglycine(mixture of E/Z conformers)

Sign In for Pricing
View Details