Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Thermoanaerobacter sp. Protease HtpX homolog (htpX)

This Recombinant Thermoanaerobacter sp. Protease HtpX homolog (htpX) spans the amino acid sequence from region 1-299.

Product Specifications

Product Name Alternative

Protease HtpX homolog, EC= 3.4.24.-

UniProt

B0K4Z5

Expression Region

1-299

Origin

Thermoanaerobacter sp. (strain X514)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSRKTLYELQAENVRKTYLFIVTFSLILFAIGYFFVWYFNWGLTGIVLLAIFIVLYNWIA YEQSDKIALASVGAIPANPEEYYVLHNIVEEVALAAGIPKPNVYIMEESQPNAFATGKDP KHASVCVTTGLLQMMNREELQGVIAHEISHIRNRDILLMTVVAVVAGLIILLRDVMLRSM WWGMGESRRRDKNDNGAIILLIIGLIFSIIAPLIVLIIRSAISRQREYLADATGAYIVRD PYGLASALEKIGNYTRPMRVTSDATAHLFISNPFGRAEKLFATHPPIEERIKRLKSLTM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD59 (heavy chain of Protectin) (BRA-10G), CF488A conjugate, 0.1mg/mL
BNC880181-500 1x 500 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF594 conjugate, 0.1mg/mL
BNC940861-100 1x 100 µL

HSP27 (G3.1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF647 conjugate, 0.1mg/mL
BNC470806-500 1x 500 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (NX2/1422R), CF740 conjugate, 0.1mg/mL
BNC741422-100 1x 100 µL

NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (NX2/1422R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ksp-Cadherin (Kidney-Specific Cadherin) / CDH16 (CDH16/1532R), CF405S conjugate, 0.1mg/mL
BNC041532-100 1x 100 µL

Ksp-Cadherin (Kidney-Specific Cadherin) / CDH16 (CDH16/1532R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (135-4C5), CF488A conjugate, 0.1mg/mL
BNC880172-500 1x 500 µL

CD45 / LCA (135-4C5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details