Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1221 (MJ1221)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1221 (MJ1221) spans the amino acid sequence from region 1-299.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ1221

UniProt

Q58618

Expression Region

1-299

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MWFGERMRYMKIIIPKKFLNTVEEILKKNNAYSISIIEPLKTSIEDGIIITCNADARDAE KIVLELKKLGLGEKGHGSVTIMPANITFSCREEGIASTSLSPLELYYKAKTMVKITKNVI IKVILASIMGVIGLIEHNIPTLIGAMIIAPLVDTVMGSAIGTVLGDKELFIQGMKKELLC SGIVIVCAFIPSLFFVSKELVLQYLSETSIILSAIVAIIAGISGGMSIASGKEYEIIGVT IDVSILIPALLMGMALATMDLYLIYITFILLAINIVLLDVGGYIGLKYKVGKINQKIKY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Endometrium
CS802544 5x 5 µm

Tissue FFPE Sections, Endometrium

Sign In for Pricing
View Details
CENPA Recombinant Rabbit monoclonal Antibody
HA750578 100 µL

CENPA Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Setd3 Mouse Gene Knockout Kit (CRISPR)
KN515626 1 Kit

Setd3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
AW551984 Mouse Gene Knockout Kit (CRISPR)
KN501888 1 Kit

AW551984 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TUFM Antibody
8C15616-AAT 50 µg

TUFM Antibody

Sign In for Pricing
View Details
beta Catenin (CTNNB1) Mouse Monoclonal Antibody [Clone ID: 4D5]
AM06389SU-N 100 µL

beta Catenin (CTNNB1) Mouse Monoclonal Antibody [Clone ID: 4D5]

Sign In for Pricing
View Details