Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ashbya gossypii Protein ARV1 (ARV1)

This Recombinant Ashbya gossypii Protein ARV1 (ARV1) spans the amino acid sequence from region 1-299.

Product Specifications

Product Name Alternative

Protein ARV1

UniProt

Q750Q7

Expression Region

1-299

Origin

Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MICINCCCHVESLYVAYPGDHIRLTDCWQCGEVVDRYVEFDNVLLFIDLLLLKPGAYRHL VYNSLEVDMRRYPEHGTRESGFRGYVQDWLLWFRKYDRLNRIWLLLITFEVYLMWMTEEK KYNNYYREPATQYGWHLLTGDVLSLQNPLLQYLFFAVYVIGDLALLHKLTRESLLNWSQW GQDLRYAKDIVSYTILLSYGAKIFPILMLIWPYDSLVSTSIIKWIANFYIVESLRIVTSK SYSYIILLFAGIFIVRSVVLKPVLALIVSRGNMLQAQRYLWGEYELFKFRFLTKRDIFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat Podoplanin/PDPN Protein (ECD, Fc Tag)
PKSR030139 200 µg

Recombinant Rat Podoplanin/PDPN Protein (ECD, Fc Tag)

Sign In for Pricing
View Details
FOXR1 Mouse Monoclonal Antibody [Clone ID: OTI3D8]
CF812051 100 µg

FOXR1 Mouse Monoclonal Antibody [Clone ID: OTI3D8]

Sign In for Pricing
View Details
METTL2A Human Gene Knockout Kit (CRISPR)
KN402672 1 Kit

METTL2A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
WT1 (Wilm's Tumor 1) (WT1/857 + 6F-H2), Biotin conjugate, 0.1mg/mL
BNCB1138-100 1x 100 µL

WT1 (Wilm's Tumor 1) (WT1/857 + 6F-H2), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RIPOR2 Human Gene Knockout Kit (CRISPR)
KN401468 1 Kit

RIPOR2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FITC Conjugated Bcl-2 Recombinant Rabbit Monoclonal Antibody [JF104-8]
HA720210F 100 µL

FITC Conjugated Bcl-2 Recombinant Rabbit Monoclonal Antibody [JF104-8]

Sign In for Pricing
View Details