Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ashbya gossypii Protein ARV1 (ARV1)

This Recombinant Ashbya gossypii Protein ARV1 (ARV1) spans the amino acid sequence from region 1-299.

Product Specifications

Product Name Alternative

Protein ARV1

UniProt

Q750Q7

Expression Region

1-299

Origin

Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MICINCCCHVESLYVAYPGDHIRLTDCWQCGEVVDRYVEFDNVLLFIDLLLLKPGAYRHL VYNSLEVDMRRYPEHGTRESGFRGYVQDWLLWFRKYDRLNRIWLLLITFEVYLMWMTEEK KYNNYYREPATQYGWHLLTGDVLSLQNPLLQYLFFAVYVIGDLALLHKLTRESLLNWSQW GQDLRYAKDIVSYTILLSYGAKIFPILMLIWPYDSLVSTSIIKWIANFYIVESLRIVTSK SYSYIILLFAGIFIVRSVVLKPVLALIVSRGNMLQAQRYLWGEYELFKFRFLTKRDIFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NSUN6 Recombinant Rabbit Monoclonal Antibody [PSH02-80]
HA721858 100 µL

NSUN6 Recombinant Rabbit Monoclonal Antibody [PSH02-80]

Sign In for Pricing
View Details
CD3e (T-Cell Marker) (rC3e/2479), CF405S conjugate, 0.1mg/mL
BNC043790-500 1x 500 µL

CD3e (T-Cell Marker) (rC3e/2479), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Promazine Dimer Hydrochloride
TRC-P756305-50MG 50 mg

Promazine Dimer Hydrochloride

Sign In for Pricing
View Details
7-Benzyloxy-D,L-tryptophan
TRC-B288500-5MG 5 mg

7-Benzyloxy-D,L-tryptophan

Sign In for Pricing
View Details
Thyroglobulin (Thyroidal Cell Marker) (TGB24), CF640R conjugate, 0.1mg/mL
BNC400024-100 1x 100 µL

Thyroglobulin (Thyroidal Cell Marker) (TGB24), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SAP155 (SF3B1) (NM_001005526) Human Over-expression Lysate
LY423624 100 µg

SAP155 (SF3B1) (NM_001005526) Human Over-expression Lysate

Sign In for Pricing
View Details