Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ashbya gossypii Protein ARV1 (ARV1)

This Recombinant Ashbya gossypii Protein ARV1 (ARV1) spans the amino acid sequence from region 1-299.

Product Specifications

Product Name Alternative

Protein ARV1

UniProt

Q750Q7

Expression Region

1-299

Origin

Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MICINCCCHVESLYVAYPGDHIRLTDCWQCGEVVDRYVEFDNVLLFIDLLLLKPGAYRHL VYNSLEVDMRRYPEHGTRESGFRGYVQDWLLWFRKYDRLNRIWLLLITFEVYLMWMTEEK KYNNYYREPATQYGWHLLTGDVLSLQNPLLQYLFFAVYVIGDLALLHKLTRESLLNWSQW GQDLRYAKDIVSYTILLSYGAKIFPILMLIWPYDSLVSTSIIKWIANFYIVESLRIVTSK SYSYIILLFAGIFIVRSVVLKPVLALIVSRGNMLQAQRYLWGEYELFKFRFLTKRDIFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Progesterone Receptor (PGR) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI24D6]
TA805434BM 100 µL

Progesterone Receptor (PGR) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI24D6]

Sign In for Pricing
View Details
SUMO2/SUMO3 Antibody
KC-6322-01 50 μL

SUMO2/SUMO3 Antibody

Sign In for Pricing
View Details
SUMO2/SUMO3 Antibody
KC-6322-02 100 µL

SUMO2/SUMO3 Antibody

Sign In for Pricing
View Details
SUMO2/SUMO3 Antibody
KC-6322-03 1 mL

SUMO2/SUMO3 Antibody

Sign In for Pricing
View Details
CD164 Monoclonal Antibody
AN200126P 100 µL

CD164 Monoclonal Antibody

Sign In for Pricing
View Details
Tau (MAPT) Rabbit Monoclonal Antibody [Clone ID: OTIR1A10]
TA592984 100 µL

Tau (MAPT) Rabbit Monoclonal Antibody [Clone ID: OTIR1A10]

Sign In for Pricing
View Details