Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Lathosterol oxidase (Sc5dl)

This Recombinant Mouse Lathosterol oxidase (Sc5dl) spans the amino acid sequence from region 1-299.

Product Specifications

Product Name Alternative

Lathosterol oxidase, EC= 1.14.21.6, C-5 sterol desaturase, Delta (7) -sterol 5-desaturase, Lathosterol 5-desaturase, Sterol-C5-desaturase

UniProt

O88822

Expression Region

1-299

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLVLSAADYYFFTPYVYPATWPEDNIIRQTISLLIVTNLGAYILYFFCATLSYYFVYDH SLMKHPQFLKNQVSREIVFTVKSLPWISIPTVSLFLLELRGYSKLYDDIGDFPNGWIHLM VSVVSFLFFTDMLIYRIHRGLHHRLVYKRIHKPHHIWKIPTPFASHAFHPVDGFLQSLPY HIYPFVFPLHKVVYLGLYVLVNVWTISIHDGDFRVPQILRPFINGSAHHTDHHMFFDYNY GQYFTLWDRIGGSFKHPSSFEGKGPHSYVKNMTEKESNSFAENGCKGKKVSNGEFTKNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADARB2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0046408 1.0 µg DNA

ADARB2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
ANTXR2 (Anthrax Toxin Receptor 2, Capillary Morphogenesis Gene 2 Protein, CMG-2, CMG2, FLJ31074, MGC111533, MGC45856)
123348 50 µg

ANTXR2 (Anthrax Toxin Receptor 2, Capillary Morphogenesis Gene 2 Protein, CMG-2, CMG2, FLJ31074, MGC111533, MGC45856)

Sign In for Pricing
View Details
GRIK1 Rabbit Polyclonal Antibody (PE)
orb2623053 100 µg

GRIK1 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
COPS8 CytoSection
TS400267P5 25 Slides

COPS8 CytoSection

Sign In for Pricing
View Details
Gpnmb siRNA Oligos set (Rat)
22479176 3x 5 nmol

Gpnmb siRNA Oligos set (Rat)

Sign In for Pricing
View Details
ANKRD63 (NM_001190479) Human Tagged ORF Clone Lentiviral Particle
RC231197L4V 200 µL

ANKRD63 (NM_001190479) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details