Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Lathosterol oxidase (Sc5dl)

This Recombinant Mouse Lathosterol oxidase (Sc5dl) spans the amino acid sequence from region 1-299.

Product Specifications

Product Name Alternative

Lathosterol oxidase, EC= 1.14.21.6, C-5 sterol desaturase, Delta (7) -sterol 5-desaturase, Lathosterol 5-desaturase, Sterol-C5-desaturase

UniProt

O88822

Expression Region

1-299

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLVLSAADYYFFTPYVYPATWPEDNIIRQTISLLIVTNLGAYILYFFCATLSYYFVYDH SLMKHPQFLKNQVSREIVFTVKSLPWISIPTVSLFLLELRGYSKLYDDIGDFPNGWIHLM VSVVSFLFFTDMLIYRIHRGLHHRLVYKRIHKPHHIWKIPTPFASHAFHPVDGFLQSLPY HIYPFVFPLHKVVYLGLYVLVNVWTISIHDGDFRVPQILRPFINGSAHHTDHHMFFDYNY GQYFTLWDRIGGSFKHPSSFEGKGPHSYVKNMTEKESNSFAENGCKGKKVSNGEFTKNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thrombomodulin Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-20395R-BF680-TR 20 µL

Thrombomodulin Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
ZRANB2 Antibody, Biotin conjugated
A39218-50UG 50 µg

ZRANB2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Human ANKRD35 qPCR Primer Pair
QH64881S 200 Tests

Human ANKRD35 qPCR Primer Pair

Sign In for Pricing
View Details
(4- (dimethylamino) phenyl) -N- (2,3-dimethyl-5-oxo-1-phenyl (3-pyrazolin-4-yl) ) formamide
YQB49820 250 mg

(4- (dimethylamino) phenyl) -N- (2,3-dimethyl-5-oxo-1-phenyl (3-pyrazolin-4-yl) ) formamide

Sign In for Pricing
View Details
TECTB Human shRNA Plasmid Kit (Locus ID 6975)
TL301158 1 Kit

TECTB Human shRNA Plasmid Kit (Locus ID 6975)

Sign In for Pricing
View Details
Sunlong Medical™ Human TNF-β/Lymphotoxin-α ELISA Kit
EL0228Hu-01 48 Tests

Sunlong Medical™ Human TNF-β/Lymphotoxin-α ELISA Kit

Sign In for Pricing
View Details