Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Lathosterol oxidase (Sc5dl)

This Recombinant Mouse Lathosterol oxidase (Sc5dl) spans the amino acid sequence from region 1-299.

Product Specifications

Product Name Alternative

Lathosterol oxidase, EC= 1.14.21.6, C-5 sterol desaturase, Delta (7) -sterol 5-desaturase, Lathosterol 5-desaturase, Sterol-C5-desaturase

UniProt

O88822

Expression Region

1-299

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLVLSAADYYFFTPYVYPATWPEDNIIRQTISLLIVTNLGAYILYFFCATLSYYFVYDH SLMKHPQFLKNQVSREIVFTVKSLPWISIPTVSLFLLELRGYSKLYDDIGDFPNGWIHLM VSVVSFLFFTDMLIYRIHRGLHHRLVYKRIHKPHHIWKIPTPFASHAFHPVDGFLQSLPY HIYPFVFPLHKVVYLGLYVLVNVWTISIHDGDFRVPQILRPFINGSAHHTDHHMFFDYNY GQYFTLWDRIGGSFKHPSSFEGKGPHSYVKNMTEKESNSFAENGCKGKKVSNGEFTKNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AGL Rabbit mAb
57002 50 µL

AGL Rabbit mAb

Sign In for Pricing
View Details
Human STAT5B Matched Antibody Pair Set [IV11196/RD1121-Biotin]
Z01LS-1122-LS252 5 Plates

Human STAT5B Matched Antibody Pair Set [IV11196/RD1121-Biotin]

Sign In for Pricing
View Details
THEMIS Recombinant Antibody, PE Conjugated
bsm-62442R-PE-01 20 µL

THEMIS Recombinant Antibody, PE Conjugated

Sign In for Pricing
View Details
THEMIS Recombinant Antibody, PE Conjugated
bsm-62442R-PE-02 100 µL

THEMIS Recombinant Antibody, PE Conjugated

Sign In for Pricing
View Details
ADAR1 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-2168R-BF680-01 20 µL

ADAR1 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
ADAR1 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-2168R-BF680-02 100 µL

ADAR1 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details