Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhodobacter sphaeroides Protease HtpX homolog (htpX)

This Recombinant Rhodobacter sphaeroides Protease HtpX homolog (htpX) spans the amino acid sequence from region 1-300.

Product Specifications

Product Name Alternative

Protease HtpX homolog, EC= 3.4.24.-

UniProt

Q3J0F7

Expression Region

1-300

Origin

Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGYVRTGILMAVMTALFLGVGALIGGQSGAIIALVIAAGMNLFTFWNSDRAVLSMHGAHE VDPRAAPDLYNMVRGLADRAGMPMPKLYLIETDQPNAFATGRNPENAAVAVTRGLLRALT PEEVAGVVAHELAHIRNRDTLLMTVTATFAGAISMLANFAFFFGGSSNEEGERPMGLVGT LALMFLAPLAAGLVQMAISRSREYEADRIGAEICGRPLWLASALGKIEGLAQRIDNVRAE RNPATAHMFIVNPLHAMGHDRLFATHPNTANRIAALRAMAEGAPQASRIPRVAARRGPWS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD46 (122.2), CF647 conjugate, 0.1mg/mL
BNC470175-500 1x 500 µL

CD46 (122.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF647 conjugate, 0.1mg/mL
BNC470630-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Napsin-A (NAPSA/1239), CF594 conjugate, 0.1mg/mL
BNC941239-100 1x 100 µL

Napsin-A (NAPSA/1239), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Progesterone Receptor (PR484), CF405S conjugate, 0.1mg/mL
BNC040484-500 1x 500 µL

Progesterone Receptor (PR484), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL
BNC740669-100 1x 100 µL

P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-x (BX006 + 2H12), CF594 conjugate, 0.1mg/mL
BNC940752-500 1x 500 µL

Bcl-x (BX006 + 2H12), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details