Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein orai (orai-1)

This Recombinant Protein orai (orai-1) spans the amino acid sequence from region 1-300.

Product Specifications

Product Name Alternative

Protein orai, Store-operated calcium channel

UniProt

Q616J1

Expression Region

1-300

Origin

Caenorhabditis briggsae

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPRSHDPSRVELLRQEGSTMNEKRVSISVEDIRGAVATWKTTSGAPITPYPLPQFFLQPP SSGGGSRNVGGGDGAAGNSKNGSMNSLRMQAYAKKTDDDVDLGHRGELDLSEKYNYDLSK AQLKASSRTSALLAGFAMVCLVELQYDDSTSKPLLIVLGVVTSLLVSVHLLALMMSTCIL PYMEATGCTQDSPHLKLKFYIDLSWLFSTCIGLLLFLVEIGVIFYVKFTAVGYPTAGYIT TAMLIPVGIVFVLFSYLIHKNRVSHSLGRFKDKVDTMKQFLDVEANLQKSTIAPSTIRDI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRTAP5-5 Human qPCR Primer Pair (NM_001001480)
HP200972 200 Reactions

KRTAP5-5 Human qPCR Primer Pair (NM_001001480)

Sign In for Pricing
View Details
CHD1 Mouse Monoclonal Antibody [2-2]
M1211-5 100 µL

CHD1 Mouse Monoclonal Antibody [2-2]

Sign In for Pricing
View Details
Horse Aromatase ELISA Kit
MBS088626-01 48 Well

Horse Aromatase ELISA Kit

Sign In for Pricing
View Details
Horse Aromatase ELISA Kit
MBS088626-02 96 Well

Horse Aromatase ELISA Kit

Sign In for Pricing
View Details
Horse Aromatase ELISA Kit
MBS088626-03 5x 96 Well

Horse Aromatase ELISA Kit

Sign In for Pricing
View Details
Horse Aromatase ELISA Kit
MBS088626-04 10x 96 Well

Horse Aromatase ELISA Kit

Sign In for Pricing
View Details