Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein orai (orai-1)

This Recombinant Protein orai (orai-1) spans the amino acid sequence from region 1-300.

Product Specifications

Product Name Alternative

Protein orai, Store-operated calcium channel

UniProt

Q616J1

Expression Region

1-300

Origin

Caenorhabditis briggsae

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPRSHDPSRVELLRQEGSTMNEKRVSISVEDIRGAVATWKTTSGAPITPYPLPQFFLQPP SSGGGSRNVGGGDGAAGNSKNGSMNSLRMQAYAKKTDDDVDLGHRGELDLSEKYNYDLSK AQLKASSRTSALLAGFAMVCLVELQYDDSTSKPLLIVLGVVTSLLVSVHLLALMMSTCIL PYMEATGCTQDSPHLKLKFYIDLSWLFSTCIGLLLFLVEIGVIFYVKFTAVGYPTAGYIT TAMLIPVGIVFVLFSYLIHKNRVSHSLGRFKDKVDTMKQFLDVEANLQKSTIAPSTIRDI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNF B Human, Sf9
32-6562-5 5 µg

TNF B Human, Sf9

Sign In for Pricing
View Details
Tcf12 3'UTR Luciferase Stable Cell Line
TU221694 1.0 mL

Tcf12 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
FIG4 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-11690R-BF594 100 µL

FIG4 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Human Retinoschisin (RS1) ELISA Kit
EK7507 48 Tests

Human Retinoschisin (RS1) ELISA Kit

Sign In for Pricing
View Details
FBXO17 Human Over-expression Lysate
orb1351003 100 µg

FBXO17 Human Over-expression Lysate

Sign In for Pricing
View Details
[ (2R,3S,4S,5R,6S) -3,4,5-trihydroxy-6- (3-hydroxy-5-methylphenoxy) oxan-2-yl]methyl trihydroxybenzoate
orb3171712-01 1 mg

[ (2R,3S,4S,5R,6S) -3,4,5-trihydroxy-6- (3-hydroxy-5-methylphenoxy) oxan-2-yl]methyl trihydroxybenzoate

Sign In for Pricing
View Details