Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acinetobacter baumannii Protease HtpX (htpX)

This Recombinant Acinetobacter baumannii Protease HtpX (htpX) spans the amino acid sequence from region 1-301.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

A3M830

Expression Region

1-301

Origin

Acinetobacter baumannii (strain ATCC 17978 / NCDC KC 755)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRIGLFLLTNLAVLVVAGIILSLFGVGSYHGAGGLNLGNLLVICFVFGMVGSLVSLFMS KWMAKKTTGTELIDPNAPRNQAESWLLQTVAELSQRAGINMPEVGIFPSYQSNAFATGWN KNDALVAVSSGLLERMNKDELRAVLAHEIGHVANGDMVTLALIQGVVNAFVMFFARVVGD FIDRNVFGRQDNEAPGMGYFIITMVLDIVFGILASAIVMWFSRYREYRADEAGARLAGKQ AMISALLRLQAETELPDQMPKEMKAFAIAEGKEQGFSLAALFQTHPTIEQRVAALHQLDC P

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Pan paniscus NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L), partial
MBS7077958 Inquire

Recombinant Pan paniscus NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L), partial

Sign In for Pricing
View Details
CD5 (CD5/54/F6) : m-IgG Fc BP-HRP Bundle
sc-526778 1 Kit

CD5 (CD5/54/F6) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
LOC367195 (NM_001047920) Rat Tagged ORF Clone
RR201074 10 µg

LOC367195 (NM_001047920) Rat Tagged ORF Clone

Sign In for Pricing
View Details
1- (2-Methoxyethyl) -5- (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) indoline
OR1065471-01 100 mg

1- (2-Methoxyethyl) -5- (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) indoline

Sign In for Pricing
View Details
1- (2-Methoxyethyl) -5- (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) indoline
OR1065471-02 250 mg

1- (2-Methoxyethyl) -5- (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) indoline

Sign In for Pricing
View Details
1- (2-Methoxyethyl) -5- (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) indoline
OR1065471-03 1 g

1- (2-Methoxyethyl) -5- (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) indoline

Sign In for Pricing
View Details