Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acinetobacter baumannii Protease HtpX (htpX)

This Recombinant Acinetobacter baumannii Protease HtpX (htpX) spans the amino acid sequence from region 1-301.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

B2HXB0

Expression Region

1-301

Origin

Acinetobacter baumannii (strain ACICU)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRIGLFLLTNLAVLVVAGIILSLFGVGSYHGAGGLNLGNLLVICFVFGMVGSLVSLFMS KWMAKKTTGTELIDPNAPRNQAESWLLQTVAELSQRAGINMPEVGIFPSYQSNAFATGWN KNDALVAVSSGLLERMNKDELRAVLAHEIGHVANGDMVTLALIQGVVNAFVMFFARVVGD FIDRNVFGRQDNEAPGMGYFIITMVLDIVFGILASAIVMWFSRYREYRADEAGARLAGKQ AMISALLRLQAETELPDQMPKEMKAFAIAEGKEQGFSLAALFQTHPTIEQRVAALHQLDC P

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ATP13A2 Antibody [Alexa Fluor 350]
NB110-41486AF350 0.1 mL

Rabbit Polyclonal ATP13A2 Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details
ARF1P2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
12249061 1.0 µg DNA

ARF1P2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Siah2 CRISPR Knock Out 293T Cell Line (Human)
43744141 1x 10^6 Cells / 1.0 mL

Siah2 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Porcine Myelin Associated Glycoprotein Antibody ELISA Kit
MBS033712-01 48 Well

Porcine Myelin Associated Glycoprotein Antibody ELISA Kit

Sign In for Pricing
View Details
Porcine Myelin Associated Glycoprotein Antibody ELISA Kit
MBS033712-02 96 Well

Porcine Myelin Associated Glycoprotein Antibody ELISA Kit

Sign In for Pricing
View Details
Porcine Myelin Associated Glycoprotein Antibody ELISA Kit
MBS033712-03 5x 96 Well

Porcine Myelin Associated Glycoprotein Antibody ELISA Kit

Sign In for Pricing
View Details