Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acinetobacter baumannii Protease HtpX (htpX)

This Recombinant Acinetobacter baumannii Protease HtpX (htpX) spans the amino acid sequence from region 1-301.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

B7I612

Expression Region

1-301

Origin

Acinetobacter baumannii (strain AB0057)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRIGLFLLTNLAVLVVAGIILSLFGVGSYHGAGGLNLGNLLVICFVFGMVGSLVSLFMS KWMAKKTTGTELIDPNAPRNQAESWLLQTVAELSQRAGINMPEVGIFPSYQSNAFATGWN KNDALVAVSSGLLERMNKDELRAVLAHEIGHVANGDMVTLALIQGVVNAFVMFFARVVGD FIDRNVFGRQDNEAPGMGYFIITMVLDIVFGILASAIVMWFSRYREYRADEAGARLAGKQ AMISALLRLQAETELPDQMPKEMKAFAIAEGKEQGFSLAALFQTHPTIEQRVAALHQLDC P

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Foxo6 3'UTR GFP Stable Cell Line
TU156705 1.0 mL

Foxo6 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
SIRT2 (NM_030593) Human Tagged ORF Clone
RC200191 10 µg

SIRT2 (NM_030593) Human Tagged ORF Clone

Sign In for Pricing
View Details
ZNF616 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV702056 1.0 µg DNA

ZNF616 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Vacuolar Protein Sorting-Associated Protein 41 (VPS41) Antibody
abx036888-01 100 µg

Vacuolar Protein Sorting-Associated Protein 41 (VPS41) Antibody

Sign In for Pricing
View Details
Vacuolar Protein Sorting-Associated Protein 41 (VPS41) Antibody
abx036888-02 1 mg

Vacuolar Protein Sorting-Associated Protein 41 (VPS41) Antibody

Sign In for Pricing
View Details
Bmp2 (NM_017178) Rat Untagged Clone
RN201404 10 µg

Bmp2 (NM_017178) Rat Untagged Clone

Sign In for Pricing
View Details