Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acinetobacter baumannii Protease HtpX (htpX)

This Recombinant Acinetobacter baumannii Protease HtpX (htpX) spans the amino acid sequence from region 1-301.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

B7I612

Expression Region

1-301

Origin

Acinetobacter baumannii (strain AB0057)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRIGLFLLTNLAVLVVAGIILSLFGVGSYHGAGGLNLGNLLVICFVFGMVGSLVSLFMS KWMAKKTTGTELIDPNAPRNQAESWLLQTVAELSQRAGINMPEVGIFPSYQSNAFATGWN KNDALVAVSSGLLERMNKDELRAVLAHEIGHVANGDMVTLALIQGVVNAFVMFFARVVGD FIDRNVFGRQDNEAPGMGYFIITMVLDIVFGILASAIVMWFSRYREYRADEAGARLAGKQ AMISALLRLQAETELPDQMPKEMKAFAIAEGKEQGFSLAALFQTHPTIEQRVAALHQLDC P

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

500mL Improved MEM Richters Mo
10-026-CV 10 / PCK

500mL Improved MEM Richters Mo

Sign In for Pricing
View Details
KPTN (Kaptin, 2E4, Actin-associated Protein 2E4) (Biotin)
MBS6383808-01 0.1 mL

KPTN (Kaptin, 2E4, Actin-associated Protein 2E4) (Biotin)

Sign In for Pricing
View Details
KPTN (Kaptin, 2E4, Actin-associated Protein 2E4) (Biotin)
MBS6383808-02 5x 0.1 mL

KPTN (Kaptin, 2E4, Actin-associated Protein 2E4) (Biotin)

Sign In for Pricing
View Details
Uracil phosphoribosyl transferase homolog (UPRT) Chicken ELISA Kit
I1500 96 Tests

Uracil phosphoribosyl transferase homolog (UPRT) Chicken ELISA Kit

Sign In for Pricing
View Details
KRT6B Antibody
orb679205 100 µL

KRT6B Antibody

Sign In for Pricing
View Details
Spermidine synthase (SRM) (NM_003132) Human Tagged ORF Clone Lentiviral Particle
RC201761L3V 200 µL

Spermidine synthase (SRM) (NM_003132) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details