Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acinetobacter baumannii Protease HtpX (htpX)

This Recombinant Acinetobacter baumannii Protease HtpX (htpX) spans the amino acid sequence from region 1-301.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

B0VT08

Expression Region

1-301

Origin

Acinetobacter baumannii (strain SDF)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRIGLFLLTNLAVLVVAGIILSLFGVGSYHGAGGLNLGNLLVICFVFGMVGSLVSLFMS KWMAKKTTGTELIDPNAPRNQAESWLLQTVAELSQRAGINMPEVGIFPSYQSNAFATGWN KNDALVAVSSGLLERMNKDELRAVLAHEIGHVANGDMVTLALIQGVVNAFVMFFARVVGD FIDRNVFGRQDNEAPGMGYFIITMVLDIVFGILASAIVMWFSRYREYRADEAGARLAGKQ AMISALLRLQAETELPDQMPKEMKAFAIAEGKEQGFSLAALFQTHPTIEQRVAALHQLDC P

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tcf21 Antibody
orb861504 2 mg

Tcf21 Antibody

Sign In for Pricing
View Details
Human Zinc finger and SCAN domain-containing protein 21 (ZSCAN21) ELISA Kit
abx384511 96 Tests

Human Zinc finger and SCAN domain-containing protein 21 (ZSCAN21) ELISA Kit

Sign In for Pricing
View Details
Human Oncostatin-M-Specific Receptor Subunit Beta (OSMR) Protein
abx620584-01 100 µg

Human Oncostatin-M-Specific Receptor Subunit Beta (OSMR) Protein

Sign In for Pricing
View Details
Human Oncostatin-M-Specific Receptor Subunit Beta (OSMR) Protein
abx620584-02 1 mg

Human Oncostatin-M-Specific Receptor Subunit Beta (OSMR) Protein

Sign In for Pricing
View Details
UCK1 Conjugated Antibody
C47232 100 µL

UCK1 Conjugated Antibody

Sign In for Pricing
View Details
p15 INK (PTR2192) Antibody
MBS9527285-01 0.02 mL

p15 INK (PTR2192) Antibody

Sign In for Pricing
View Details