Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Alkalilimnicola ehrlichei Protease HtpX (htpX)

This Recombinant Alkalilimnicola ehrlichei Protease HtpX (htpX) spans the amino acid sequence from region 1-301.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

Q0AAR8

Expression Region

1-301

Origin

Alkalilimnicola ehrlichei (strain MLHE-1)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKRIGLFLLTNLAILVVLGVVLFILQAVFGVRTLDEAGVGLDYTGLLIIAAVIGFGGSFI SLAMSKFIAKRMTGARVIEKPRSEAEQWLVDTVRRFARQEGIGMPEVAIYDAPDMNAFAT GARRNNSLVAVSTGLLQSMTRDEAEAVIGHEIAHISNGDMVTLTLIQGVVNTFVVFFSRI IGHFVDRVVFKTEQGHGPAYFITSIFAQIVLGILASVIVMWFSRQREYRADAGGAKLAGR DKMIAALERLKRSVDQEHLPDQLEAFGINGNRGGGMKEWFMSHPPLDDRIAALKEGRHLR G

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P53 (PAb122), CF740 conjugate, 0.1mg/mL
BNC740338-100 1x 100 µL

P53 (PAb122), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF770 conjugate, 0.1mg/mL
BNC700164-500 1x 500 µL

CD28 (204.12), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL
BNC681820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF594 conjugate, 0.1mg/mL
BNC940146-100 1x 100 µL

CD10 (CB-CALLA), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P63 (Squamous, Basal and Myoepithelial Cell Marker) (TP63/1786), CF488A conjugate, 0.1mg/mL
BNC881786-100 1x 100 µL

P63 (Squamous, Basal and Myoepithelial Cell Marker) (TP63/1786), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 / Complement Regulatory Protein / Protectin (MACIF/2867R), CF640R conjugate, 0.1mg/mL
BNC402867-100 1x 100 µL

CD59 / Complement Regulatory Protein / Protectin (MACIF/2867R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details