Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein unc-50 (unc-50)

This Recombinant Protein unc-50 (unc-50) spans the amino acid sequence from region 1-301.

Product Specifications

Product Name Alternative

Protein unc-50, Uncoordinated protein 50

UniProt

Q10045

Expression Region

1-301

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSQPRGSGTQPGPSQSPISQRNFRYEPARSGYTSPGQYSTYSTSTADRVGCLTAVRMSA FAKLSRFTRRLVHIRQMDFEFALWQMLYLLIQPSKVYKNFIYRKRTKDQFARDDPAFLVL LALSLLFSSIFYAYALGLEKIGFFTFFLWSVFVDCIGVGVVIATVLWWVSNRFLRKVRDQ DVEWGYCFDVHLNAFFPMLILLHVIVPILYPTLIDSPAFLSILLGNTFWFLAACYYVYIT FLGYTALPILHKTQYFLYPISFIFMFFVATLTGGWNISRTALNFYHSRAEPHKFAPQHGG L

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FIAA Rabbit Polyclonal Antibody (Cy3)
orb979944 100 µL

FIAA Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
SMAP1, NT (SMAP1, Stromal membrane-associated protein 1) (APC) discontinued
042030-APC 200 µL

SMAP1, NT (SMAP1, Stromal membrane-associated protein 1) (APC) discontinued

Sign In for Pricing
View Details
TCAB1 Rabbit Polyclonal Antibody (Cy5)
orb880627 100 µL

TCAB1 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
HRSP12 Rabbit Polyclonal Antibody (BF594)
orb2442143 100 µL

HRSP12 Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
4-Chlorophenyl Isocyanate
431889-01 5 g

4-Chlorophenyl Isocyanate

Sign In for Pricing
View Details
4-Chlorophenyl Isocyanate
431889-02 50 g

4-Chlorophenyl Isocyanate

Sign In for Pricing
View Details