Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanococcoides burtonii Tetrahydromethanopterin S-methyltransferase subunit E (mtrE)

This Recombinant Methanococcoides burtonii Tetrahydromethanopterin S-methyltransferase subunit E (mtrE) spans the amino acid sequence from region 1-301.

Product Specifications

Product Name Alternative

Tetrahydromethanopterin S-methyltransferase subunit E, EC= 2.1.1.86, N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit E

UniProt

Q12VU4

Expression Region

1-301

Origin

Methanococcoides burtonii (strain DSM 6242)

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEPLMGMGVLALMGAAATIAGTTEDLESDVGSQSNPNSQVQLAPQMMYPHRIYNKAISGE PPSNALICAIGGTVASVLMTANLSVIFAIAIGALVASAVHGTYCITAYMGRTASQKRFRQ PIYLDILRSHTPVMMGYAFITTFCILVVSYIMVAVLAHPFPLTLLAFIWGITVGAIGSST GDVHYGAEREFQNVEFGSGLNAANSGNIVRKAESGLRNGIDNSWFCAKFGGPVTGLAFGM TVFLSGWVTAVFNPAISLTMGWLSVAAGVILVLLLIIWNRKIEVAARKAFGPYKEEEEVA A

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (B-B12), CF488A conjugate, 0.1mg/mL
BNC881052-100 1x 100 µL

CD3e (B-B12), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF405S conjugate, 0.1mg/mL
BNC040449-500 1x 500 µL

CD104 (UM-A9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF568 conjugate, 0.1mg/mL
BNC681429-100 1x 100 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF568 conjugate, 0.1mg/mL
BNC680029-100 1x 100 µL

Fibronectin (TV-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RB (PD7/26), CF405S conjugate, 0.1mg/mL
BNC040472-100 1x 100 µL

CD45RB (PD7/26), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2038), CF740 conjugate, 0.1mg/mL
BNC742038-100 1x 100 µL

Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2038), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details