Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanococcoides burtonii Tetrahydromethanopterin S-methyltransferase subunit E (mtrE)

This Recombinant Methanococcoides burtonii Tetrahydromethanopterin S-methyltransferase subunit E (mtrE) spans the amino acid sequence from region 1-301.

Product Specifications

Product Name Alternative

Tetrahydromethanopterin S-methyltransferase subunit E, EC= 2.1.1.86, N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit E

UniProt

Q12VU4

Expression Region

1-301

Origin

Methanococcoides burtonii (strain DSM 6242)

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEPLMGMGVLALMGAAATIAGTTEDLESDVGSQSNPNSQVQLAPQMMYPHRIYNKAISGE PPSNALICAIGGTVASVLMTANLSVIFAIAIGALVASAVHGTYCITAYMGRTASQKRFRQ PIYLDILRSHTPVMMGYAFITTFCILVVSYIMVAVLAHPFPLTLLAFIWGITVGAIGSST GDVHYGAEREFQNVEFGSGLNAANSGNIVRKAESGLRNGIDNSWFCAKFGGPVTGLAFGM TVFLSGWVTAVFNPAISLTMGWLSVAAGVILVLLLIIWNRKIEVAARKAFGPYKEEEEVA A

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyp4a30b-ps 3'UTR Luciferase Stable Cell Line
TU104707 1.0 mL

Cyp4a30b-ps 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
FA2H antibody
70R-17188 50 ul

FA2H antibody

Sign In for Pricing
View Details
Lentiviral mouse Aspn shRNA (UAS) - Lentiviral mouse Aspn shRNA (UAS, RFP) plasmid
GTR15197881 1 Vial

Lentiviral mouse Aspn shRNA (UAS) - Lentiviral mouse Aspn shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Rat Cytochrome c oxidase subunit 5A, mitochondrial ELISA Kit
MBS288899-01 48 Well

Rat Cytochrome c oxidase subunit 5A, mitochondrial ELISA Kit

Sign In for Pricing
View Details
Rat Cytochrome c oxidase subunit 5A, mitochondrial ELISA Kit
MBS288899-02 96 Well

Rat Cytochrome c oxidase subunit 5A, mitochondrial ELISA Kit

Sign In for Pricing
View Details
Rat Cytochrome c oxidase subunit 5A, mitochondrial ELISA Kit
MBS288899-03 5x 96 Well

Rat Cytochrome c oxidase subunit 5A, mitochondrial ELISA Kit

Sign In for Pricing
View Details