Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rickettsia rickettsii Protein p34 (p34)

This Recombinant Rickettsia rickettsii Protein p34 (p34) spans the amino acid sequence from region 1-301.

Product Specifications

Product Name Alternative

Protein p34

UniProt

P21559

Expression Region

1-301

Origin

Rickettsia rickettsii (strain Sheila Smith)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDTNSRNRLIKSASYLSVTTALIILSIKLYAWVVTDSQSILAALIDSMLDITSSFINLIA LRFALQPPDHHHRFGYEKLQDLTIFSQSIFFFASAFFVGFSSVKSLFEKTKPENISDGTT VMYVCIFLTIILVFYQTYVIKKTGSEIVKADKLHYFTDLLTNVIVIISINLSDYFWFVDP LFGVVISLYIFHSSYSLFKKAFKNLVDHELPEQDRQKIISIVNNHLGAKGMHEMKTRYAG QKAFIQCHLEMDGNMSLYNAHKISDEIAFEILQEFPEAEIIIHQDPFGIEEHVKYREYIV R

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Von Willebrand Factor (3E2D10), CF405S conjugate, 0.1mg/mL
BNC040633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF647 conjugate, 0.1mg/mL
BNC470324-500 1x 500 µL

CD53 (161-2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF647 conjugate, 0.1mg/mL
BNC470322-100 1x 100 µL

CD3e (RIV9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF568 conjugate, 0.1mg/mL
BNC680181-500 1x 500 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF647 conjugate, 0.1mg/mL
BNC470096-100 1x 100 µL

Histone H1 (AE-4), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PLAP (Placental Alkaline Phosphatase) (PL8-F6), CF405S conjugate, 0.1mg/mL
BNC040889-500 1x 500 µL

PLAP (Placental Alkaline Phosphatase) (PL8-F6), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details