Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Uncharacterized plasma membrane protein YNL194C (YNL194C)

This Recombinant Saccharomyces cerevisiae Uncharacterized plasma membrane protein YNL194C (YNL194C) spans the amino acid sequence from region 1-301.

Product Specifications

Product Name Alternative

Uncharacterized plasma membrane protein YNL194C

UniProt

P40169

Expression Region

1-301

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSYKKFVYFINLFFLLGATLLTFFLILAGGRTTGVLKNFYWFQASTSGFNSAPSVTRWYN YNWCGWESRGIAVNCSSKMAAQPFSPRDNFGSSPLMPSTFLNNRNAYYYLSRVGWAMLLI GLFFLLITLVSVIASLIRYNRRTAALATAMSWITLFFITLSACLYTGCYAKAVKAFHHEN RDARLGPKNFGLIWTTVFLLIVNAICCTIMVATHKRNEYIYDRSFASTKTVDSQTPTPVP TNGGIPSSVPVTEVQQSQSHQNHRFFKKLRTKKRTVTSAGDEPDRVQEERVYTEQNVPVV S

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD28 (204.12), CF568 conjugate, 0.1mg/mL
BNC680164-100 1x 100 µL

CD28 (204.12), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ATRX / RAD54 (Alpha Thalassemia Mental Retardation) (ATRX/2900R), CF488A conjugate, 0.1mg/mL
BNC882900-500 1x 500 µL

ATRX / RAD54 (Alpha Thalassemia Mental Retardation) (ATRX/2900R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NGFR (Nerve Growth Factor Receptor) (NGFR5 + NTR/912), CF405S conjugate, 0.1mg/mL
BNC040914-100 1x 100 µL

NGFR (Nerve Growth Factor Receptor) (NGFR5 + NTR/912), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD19 (CVID3/429), CF740 conjugate, 0.1mg/mL
BNC740429-100 1x 100 µL

CD19 (CVID3/429), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (K8.8 + DC10), CF405S conjugate, 0.1mg/mL
BNC040691-100 1x 100 µL

Cytokeratin 8/18 (K8.8 + DC10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HER-2 / c-erbB-2 / neu / CD340 (ERBB2/2452), CF488A conjugate, 0.1mg/mL
BNC882452-100 1x 100 µL

HER-2 / c-erbB-2 / neu / CD340 (ERBB2/2452), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details