Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Cardiolipin synthase (Crls1)

This Recombinant Rat Cardiolipin synthase (Crls1) spans the amino acid sequence from region 1-302.

Product Specifications

Product Name Alternative

Cardiolipin synthase, CLS, EC= 2.7.8.-

UniProt

Q5U2V5

Expression Region

1-302

Origin

Rattus norvegicus (Rat)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLAWRVARGAWGSLRVAVRPPGARLGRGGSRRALLPPAACCLGCLAERWRLRPAAFALRL PGTSPRTHCSGAGKAAPEPAAGGDAAAQAPSARWVRASATSSYENPWTIPNLLSMTRIGL APVLGYLILEEDFNVALGVFALAGLTDLLDGFIARNWANQKSALGSALDPLADKVLISIL YISLTYADLIPVPLTYMIISRDVMLIAAVFYVRYRTLPTPRTLAKYFNPCYATARLKPTF ISKVNTAVQLILVAASLAAPVFNYADSIYLQILWCCTAFTTAASAYSYYHYGRKTVQVIK GK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMPK alpha 1 (PRKAA1) Human Gene Knockout Kit (CRISPR)
KN418572 1 Kit

AMPK alpha 1 (PRKAA1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
AKR1C2 (NM_001135241) Human Recombinant Protein
TP720265M 50 µg

AKR1C2 (NM_001135241) Human Recombinant Protein

Sign In for Pricing
View Details
Nestin Polyclonal Antibody
E-AB-63599-01 60 µL

Nestin Polyclonal Antibody

Sign In for Pricing
View Details
Nestin Polyclonal Antibody
E-AB-63599-02 120 µL

Nestin Polyclonal Antibody

Sign In for Pricing
View Details
Nestin Polyclonal Antibody
E-AB-63599-03 200 µL

Nestin Polyclonal Antibody

Sign In for Pricing
View Details
DUS4L Human Gene Knockout Kit (CRISPR)
KN422488 1 Kit

DUS4L Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details