Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas stutzeri Cobalamin biosynthesis protein CobD (cobD)

This Recombinant Pseudomonas stutzeri Cobalamin biosynthesis protein CobD (cobD) spans the amino acid sequence from region 1-303.

Product Specifications

Product Name Alternative

Cobalamin biosynthesis protein CobD

UniProt

A4VJ38

Expression Region

1-303

Origin

Pseudomonas stutzeri (strain A1501)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSVFLSVIGALLLDALLGEPKRAHPLVAFGRLADRLEQHFNGAAGRGWRSHGVTAWCLAV LPLTLLAWLLSLLPGIGWLAEIVLLYLALGLRSLGEHALPVAQALWRHDLPEARRRVACI VSRDTSQLDEEGVARAATESVLENGSDAVFAALFWFIVAGAPGVVLYRLSNTLDAMWGYR NARFERFGWAAARIDDLLNYVPARLVAVTYALLGRTRRALRCWRTQAPLWDSPNAGPVMA AGAGALGVVLGGAAIYHGELHARPELGRGSAPQARHIEHALDLVWAGVGVWLLVLLFGGW LYA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Furin Protein Vector (Rat) (pPM-C-His)
PV269173 500 ng

Furin Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
KRTHB3 Antibody (YA7387, Rabbit)
HY-P87702 1 Each

KRTHB3 Antibody (YA7387, Rabbit)

Sign In for Pricing
View Details
UNC93B1 Lentiviral Activation Particles (m)
sc-424872-LAC 200 µL

UNC93B1 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
PRMT3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1724806 1.0 µg DNA

PRMT3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
WKYMVM 2TFA (187986-17-0 (free base) )
M22772-01 1 g

WKYMVM 2TFA (187986-17-0 (free base) )

Sign In for Pricing
View Details
WKYMVM 2TFA (187986-17-0 (free base) )
M22772-02 100 mg

WKYMVM 2TFA (187986-17-0 (free base) )

Sign In for Pricing
View Details