Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas stutzeri Cobalamin biosynthesis protein CobD (cobD)

This Recombinant Pseudomonas stutzeri Cobalamin biosynthesis protein CobD (cobD) spans the amino acid sequence from region 1-303.

Product Specifications

Product Name Alternative

Cobalamin biosynthesis protein CobD

UniProt

A4VJ38

Expression Region

1-303

Origin

Pseudomonas stutzeri (strain A1501)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSVFLSVIGALLLDALLGEPKRAHPLVAFGRLADRLEQHFNGAAGRGWRSHGVTAWCLAV LPLTLLAWLLSLLPGIGWLAEIVLLYLALGLRSLGEHALPVAQALWRHDLPEARRRVACI VSRDTSQLDEEGVARAATESVLENGSDAVFAALFWFIVAGAPGVVLYRLSNTLDAMWGYR NARFERFGWAAARIDDLLNYVPARLVAVTYALLGRTRRALRCWRTQAPLWDSPNAGPVMA AGAGALGVVLGGAAIYHGELHARPELGRGSAPQARHIEHALDLVWAGVGVWLLVLLFGGW LYA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cy3-Linked Polyclonal Antibody to Transglutaminase 3, Epidermal (TGM3)
MBS2058679-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Transglutaminase 3, Epidermal (TGM3)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Transglutaminase 3, Epidermal (TGM3)
MBS2058679-02 0.2 mL

Cy3-Linked Polyclonal Antibody to Transglutaminase 3, Epidermal (TGM3)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Transglutaminase 3, Epidermal (TGM3)
MBS2058679-03 0.5 mL

Cy3-Linked Polyclonal Antibody to Transglutaminase 3, Epidermal (TGM3)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Transglutaminase 3, Epidermal (TGM3)
MBS2058679-04 1 mL

Cy3-Linked Polyclonal Antibody to Transglutaminase 3, Epidermal (TGM3)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Transglutaminase 3, Epidermal (TGM3)
MBS2058679-05 5 mL

Cy3-Linked Polyclonal Antibody to Transglutaminase 3, Epidermal (TGM3)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Transglutaminase 3, Epidermal (TGM3)
MBS2058679-06 5x 5 mL

Cy3-Linked Polyclonal Antibody to Transglutaminase 3, Epidermal (TGM3)

Sign In for Pricing
View Details