Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Psychrobacter sp. Protease HtpX (htpX)

This Recombinant Psychrobacter sp. Protease HtpX (htpX) spans the amino acid sequence from region 1-303.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

A5WHL4

Expression Region

1-303

Origin

Psychrobacter sp. (strain PRwf-1)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRIGLFLLTNLAVLVVFSIVFGILSSVFGLGSVHGAGGLNIASLAVMCAVYGMIGSMIS LFLSKWMAKRSTGTVVIEQPRNASEQWLVETVAKQAKAVNIDMPEVGIFDNAQPNAFATG WNKNKALVAVSSGLLHTMTPDEVEAVLAHEIGHVANGDMVTLALIQGVVNAFVMFFARIV GSFVDRVVFKNEDGPGIGYFVTSIVMDILLGFLASAIVMWFSRQREFRADAMGAKLAGRD KMISALNALRPAEARPDQMPENMQAFAISSGQTQGFSIANFFRSHPTLDDRIEALKKYTP GQS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cortisone Sodium Succinate
TRC-C696505-10MG 10 mg

Cortisone Sodium Succinate

Sign In for Pricing
View Details
14-3-3 zeta (YWHAZ) (NM_001135699) Human Recombinant Protein
TP326946 20 µg

14-3-3 zeta (YWHAZ) (NM_001135699) Human Recombinant Protein

Sign In for Pricing
View Details
IDO1 (C-term) Rabbit Polyclonal Antibody
AP12352PU-N 400 µL

IDO1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Sacs Mouse Gene Knockout Kit (CRISPR)
KN515260 1 Kit

Sacs Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Red Fluorescent SR101-Phe-CMK Serine Protease Assay Kit
952 100 Tests

Red Fluorescent SR101-Phe-CMK Serine Protease Assay Kit

Sign In for Pricing
View Details
4-(3,4-Dihydroxyphenyl)butyric Acid
TRC-D452365-25MG 25 mg

4-(3,4-Dihydroxyphenyl)butyric Acid

Sign In for Pricing
View Details