Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Psychrobacter sp. Protease HtpX (htpX)

This Recombinant Psychrobacter sp. Protease HtpX (htpX) spans the amino acid sequence from region 1-303.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

A5WHL4

Expression Region

1-303

Origin

Psychrobacter sp. (strain PRwf-1)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRIGLFLLTNLAVLVVFSIVFGILSSVFGLGSVHGAGGLNIASLAVMCAVYGMIGSMIS LFLSKWMAKRSTGTVVIEQPRNASEQWLVETVAKQAKAVNIDMPEVGIFDNAQPNAFATG WNKNKALVAVSSGLLHTMTPDEVEAVLAHEIGHVANGDMVTLALIQGVVNAFVMFFARIV GSFVDRVVFKNEDGPGIGYFVTSIVMDILLGFLASAIVMWFSRQREFRADAMGAKLAGRD KMISALNALRPAEARPDQMPENMQAFAISSGQTQGFSIANFFRSHPTLDDRIEALKKYTP GQS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZC3H8 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI13F2]
TA808343AM 100 µL

ZC3H8 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI13F2]

Sign In for Pricing
View Details
CLEC9A / DNGR1 (Dendritic Cell Marker) (8F9), CF740 conjugate, 0.1mg/mL
BNC743063-100 1x 100 µL

CLEC9A / DNGR1 (Dendritic Cell Marker) (8F9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Peptidyl Arginine Deiminase Type II (PADI2) ELISA Kit
RD-PADI2-Hu-01 96 Tests

Human Peptidyl Arginine Deiminase Type II (PADI2) ELISA Kit

Sign In for Pricing
View Details
Human Peptidyl Arginine Deiminase Type II (PADI2) ELISA Kit
RD-PADI2-Hu-02 48 Tests

Human Peptidyl Arginine Deiminase Type II (PADI2) ELISA Kit

Sign In for Pricing
View Details
Multi-parameter Analyzer BMET-606
BMET-606 1 Unit

Multi-parameter Analyzer BMET-606

Sign In for Pricing
View Details
Uncoated Rat ACV-A (Activin A) ELISA Kit
E-UNEL-R0082-01 5x 96 Tests

Uncoated Rat ACV-A (Activin A) ELISA Kit

Sign In for Pricing
View Details