Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein ybfF (ybfF)

This Recombinant Bacillus subtilis Uncharacterized protein ybfF (ybfF) spans the amino acid sequence from region 1-303.

Product Specifications

Product Name Alternative

Uncharacterized protein ybfF

UniProt

O31446

Expression Region

1-303

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNDQIVFEKTKNIAHDINQMQNQQEIIDYLFRQDSLTLNQLKHYYSEPSLPLQFLVKVA VLCMFISMTLASFLFIQAKEVFTNTILSDISPAVFSIFTVICIFMTYTKIIKKGNKNKGK ASLNQRSEFYEKNKLINTILYKKYKMDQQNIQANKHTASDNEDSMNFSAVLNHVLTISKN DKELLGYLDTRDNAMLSQLKAYFSTRPFSLPHYMSLMFCGSIIVVYATSLFSGQINYIDI PHIFIFLLLIIFLKILIDLIKLLNISRKGQLHTVLHFAQRAEYLRMRGVIDFILTERYNK KIM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tau, phosphorylated (Ser404) (Tau Protein, Microtubule-associated Protein, MAP)
MBS627847-01 0.1 mL

Tau, phosphorylated (Ser404) (Tau Protein, Microtubule-associated Protein, MAP)

Sign In for Pricing
View Details
Tau, phosphorylated (Ser404) (Tau Protein, Microtubule-associated Protein, MAP)
MBS627847-02 5x 0.1 mL

Tau, phosphorylated (Ser404) (Tau Protein, Microtubule-associated Protein, MAP)

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS510546 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
KARS, NT (KARS, KIAA0070, Lysine-tRNA ligase, Lysyl-tRNA synthetase) (Biotin) discontinued
037272-Biotin 200 µL

KARS, NT (KARS, KIAA0070, Lysine-tRNA ligase, Lysyl-tRNA synthetase) (Biotin) discontinued

Sign In for Pricing
View Details
Classic 7 boxes 75mm, 557x140x140mm, w/locking rod, B10
TE21464B10 1 Piece

Classic 7 boxes 75mm, 557x140x140mm, w/locking rod, B10

Sign In for Pricing
View Details
Anti-Phospho-HTRA2 (pS212) Antibody (P6.C12)
HT447013-01 50 µg

Anti-Phospho-HTRA2 (pS212) Antibody (P6.C12)

Sign In for Pricing
View Details